PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P00050_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TCP
Protein Properties Length: 343aa    MW: 36310.9 Da    PI: 10.1064
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P00050_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP114.11.8e-3561126671
                    TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71 
                            +r++++hTkv+gR+RR+R++a caar+F+L++eLG+++d++ti+WLl+ a+pai+++tgt++ +a 
  GSMUA_Achr8P00050_001  61 SRTKDRHTKVEGRGRRIRMPAACAARIFQLTRELGHKSDGETIQWLLEHAEPAIIAATGTGTVPAI 126
                            69**********************************************************887773 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.7E-2962129IPR005333Transcription factor, TCP
PROSITE profilePS5136927.47463117IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MESQTHGEED RRRKTDLGAG GGGGAVPTPA VIPVHRFIVP KPEPMEMLGM RAFQIMRRPA  60
SRTKDRHTKV EGRGRRIRMP AACAARIFQL TRELGHKSDG ETIQWLLEHA EPAIIAATGT  120
GTVPAIATNI GGTLKIPTEA PTSAPPSRTG GGTVIAGYYP VQDPLLPVGG AISISSGLAP  180
TAGGAQGMVP VWALGGGAAA ASVIPPGALW VLPPPSATAG TSSQSQAWTF PQAPQIVNLA  240
TSRPISTDAL FSGGAHGVNV ATTAGGKHEL QLMSASGEPL RVMGCRFLLN TILTLMQVLE  300
ERTKNSCYKL WRKLEDFIRE EKRFNDWIVY SGSICILVKN MLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009412824.11e-180PREDICTED: transcription factor PCF2-like
SwissprotA2YXQ17e-59PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH67e-59PCF2_ORYSJ; Transcription factor PCF2
TrEMBLM0TLA70.0M0TLA7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P00050_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.16e-47TCP family protein